Structure of PDB 8jrr Chain D |
>8jrrD (length=131) Species: 333760 (Human papillomavirus 16) [Search protein sequence] |
PQERPRKLPQLCTELQTTILECVYCKQQLLRREVYDFAFRDLCIVYRDGN PYAVCDKCLKFYSKISEYRHYSYSLYGTTLEQQYNKPLSDLLIRCINCQK PLSPEEKQRHLDKKQRFHNIRGRWTGRCMSC |
|
PDB | 8jrr Structural insights into the functional mechanism of the ubiquitin ligase E6AP. |
Chain | D |
Resolution | 4.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
Y39 C73 |
Y24 C58 |
|
|
|