Structure of PDB 8jro Chain D

Receptor sequence
>8jroD (length=141) Species: 333760 (Human papillomavirus 16) [Search protein sequence]
FQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLC
IVYRDGNPYAVCDKCLKFYSKISEYRHYSYSLYGTTLEQQYNKPLSDLLI
RCINCQKPLSPEEKQRHLDKKQRFHNIRGRWTGRCMSCSRS
3D structure
PDB8jro Structural insights into the functional mechanism of the ubiquitin ligase E6AP.
ChainD
Resolution3.01 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN D C37 C40 C70 C73 C29 C32 C62 C65
BS02 ZN D C110 C143 C146 C102 C135 C138
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030165 PDZ domain binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0019049 virus-mediated perturbation of host defense response
GO:0030162 regulation of proteolysis
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039548 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity
GO:0039648 symbiont-mediated perturbation of host ubiquitin-like protein modification
GO:0039653 symbiont-mediated suppression of host transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0052150 symbiont-mediated perturbation of host apoptosis
GO:0090630 activation of GTPase activity
Cellular Component
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8jro, PDBe:8jro, PDBj:8jro
PDBsum8jro
PubMed38670961
UniProtP03126|VE6_HPV16 Protein E6 (Gene Name=E6)

[Back to BioLiP]