Structure of PDB 8jp7 Chain D

Receptor sequence
>8jp7D (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
LDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDG
LELSTAITHVHQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKS
3D structure
PDB8jp7 Structure of full-length ERGIC-53 in complex with MCFD2 for cargo transport.
ChainD
Resolution3.51 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA D D129 N131 D133 Y135 E140 D83 N85 D87 Y89 E94
BS02 CA D D81 D83 N85 L87 E92 D41 D43 N45 L47 E52
BS03 ZN D H51 H55 H99 H101 H11 H15 H59 H61
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005793 endoplasmic reticulum-Golgi intermediate compartment
GO:0005794 Golgi apparatus
GO:0012507 ER to Golgi transport vesicle membrane
GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jp7, PDBe:8jp7, PDBj:8jp7
PDBsum8jp7
PubMed38493152
UniProtQ8NI22|MCFD2_HUMAN Multiple coagulation factor deficiency protein 2 (Gene Name=MCFD2)

[Back to BioLiP]