Structure of PDB 8jho Chain D

Receptor sequence
>8jhoD (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence]
RRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
3D structure
PDB8jho Structure of histone deacetylase complex Rpd3S bound to nucleosome
ChainD
Resolution7.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R26 R27 K28 R30 K31 I36 R1 R2 K3 R5 K6 I11
BS02 dna D R26 T29 R30 Y39 G50 I51 S52 S53 R83 S84 T85 R1 T4 R5 Y14 G25 I26 S27 S28 R58 S59 T60
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8jho, PDBe:8jho, PDBj:8jho
PDBsum8jho
PubMed37798513
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]