Structure of PDB 8jhg Chain D |
>8jhgD (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] |
RSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK |
|
PDB | 8jhg Structural basis of nucleosomal H4K20 recognition and methylation by SUV420H1 methyltransferase |
Chain | D |
Resolution | 3.58 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
D |
Y39 S53 |
Y12 S26 |
|
|
|
|