Structure of PDB 8jfg Chain D

Receptor sequence
>8jfgD (length=236) Species: 210 (Helicobacter pylori) [Search protein sequence]
SMQFTGKNVLITGASKGIGAEIARTLASMGLKVWINYRSNAEVADALKNE
LEEKGYKAAVIKFDAASESDFVEAIQAIVQSDGGLSYLVNNAGVVRDKLA
IKMKTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNIASIIGERGN
MGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIEADYVKNIPLN
RLGAAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM
3D structure
PDB8jfg The Molecular Basis of Catalysis by SDR Family Members Ketoacyl-ACP Reductase FabG and Enoyl-ACP Reductase FabI in Type-II Fatty Acid Biosynthesis.
ChainD
Resolution2.83 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 NAP D G16 I17 R37 D63 A64 N90 G92 N113 I140 A141 S142 Y155 K159 P185 G17 I18 R38 D64 A65 N91 G93 N114 I141 A142 S143 Y156 K160 P186
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 30 23:46:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jfg', asym_id = 'D', title = 'The Molecular Basis of Catalysis by SDR Family M...ductase FabI in Type-II Fatty Acid Biosynthesis. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jfg', asym_id='D', title='The Molecular Basis of Catalysis by SDR Family M...ductase FabI in Type-II Fatty Acid Biosynthesis. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004316,0006633,0016491,0051287', uniprot = '', pdbid = '8jfg', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004316,0006633,0016491,0051287', uniprot='', pdbid='8jfg', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>