Structure of PDB 8hq9 Chain D |
>8hq9D (length=105) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
EPTYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTYLPRVTLEI EQRYNHIPDTSSLSIRTSGLLGEQYLALNVGFEDPELGTAILKDGDTIQD TKSAM |
|
PDB | 8hq9 The structural features of MlaD illuminate its unique ligand-transporting mechanism and ancestry |
Chain | D |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
D |
T45 T137 |
T9 T101 |
|
|
|
|