Structure of PDB 8hni Chain D

Receptor sequence

>8hniD (length=179) Species: 9606 (Homo sapiens) [Search protein sequence]

REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGF
GFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKL
FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHD
PVDKIVLQKYHTINGHNAEVRKALSRQEM

3D structure

PDB

8hni Structural Insight Into hnRNP A2/B1 Homodimerization and DNA Recognition.

Chain

Resolution

2.644 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	F24 G27 L28 S29 F30 D49 V51 M53 R62 F64 F66 R89 E92 K94 A96 V97 A98 R99 H108	F10 G13 L14 S15 F16 D35 V37 M39 R48 F50 F52 R75 E78 K80 A82 V83 A84 R85 H94
BS02	dna	D	F115 G118 I144 R153 F155 F157 R185 A187 L188 S189 R190 M193	F101 G104 I130 R139 F141 F143 R171 A173 L174 S175 R176 M179

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:8hni, PDBe:8hni, PDBj:8hni
PDBsum	8hni
PubMed	36528084
UniProt	P22626\|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (Gene Name=HNRNPA2B1)

[Back to BioLiP]