Structure of PDB 8fms Chain D

Receptor sequence
>8fmsD (length=158) Species: 9606 (Homo sapiens) [Search protein sequence]
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQ
NPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSDSKGKSEEELSDLFRM
FDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEF
LEFMKGVE
3D structure
PDB8fms Structural and Phenotypic Correction of K210del Genetic Cardiomyopathy by an FDA Approved drug
ChainD
Resolution3.435 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA D D67 S69 T71 E76 D67 S69 T71 E76
BS02 CA D D105 N107 D109 Y111 E116 D102 N104 D106 Y108 E113
BS03 CA D D141 N143 D145 R147 E152 D138 N140 D142 R144 E149
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0031013 troponin I binding
GO:0031014 troponin T binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0051015 actin filament binding
Biological Process
GO:0002086 diaphragm contraction
GO:0003009 skeletal muscle contraction
GO:0006937 regulation of muscle contraction
GO:0010038 response to metal ion
GO:0014883 transition between fast and slow fiber
GO:0032972 regulation of muscle filament sliding speed
GO:0043462 regulation of ATP-dependent activity
GO:0055010 ventricular cardiac muscle tissue morphogenesis
GO:0060048 cardiac muscle contraction
Cellular Component
GO:0005829 cytosol
GO:0005861 troponin complex
GO:0043292 contractile muscle fiber
GO:1990584 cardiac Troponin complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fms, PDBe:8fms, PDBj:8fms
PDBsum8fms
PubMed
UniProtP63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles (Gene Name=TNNC1)

[Back to BioLiP]