Structure of PDB 8f5k Chain D |
>8f5kD (length=124) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLS TAADMQGVVTDGMASGLDKDFLKPDDSRVIAHTKLIGSGEKDSVTFDVSK LKEQFMAFCTFPGHSALMKGTLTL |
|
PDB | 8f5k Electrochemical and Structural Study of the Buried Tryptophan in Azurin: Effects of Hydration and Polarity on the Redox Potential of W48. |
Chain | D |
Resolution | 1.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
D |
G45 H46 C112 H117 |
G44 H45 C109 H114 |
|
|
|
|