Structure of PDB 8eqm Chain D

Receptor sequence

>8eqmD (length=338) Species: 91464 (Synechococcus sp. PCC 7335) [Search protein sequence]

WIKQLDDWLKRDRFVFIGWSGLLLFPCSFLAIGAWFTGTTFVTSWYTHGL
VSSYLEGCNFLTVAVSTPAESMGHSLLLLWGPEASGDFVRWCQIGGLWTF
TALHGVFGLIGFMLRQIEIARLVGIRPYNAIAFSAPIAVYCATFLIYPLG
QSSWFFGPGFGVSAIFRFLLFFQGFHNYTLNPFHMMGVTGVLGGALLCAI
HGATVQNTLFRDNQSKNTFKGFSTDQGEETYSMVTANRFWSQIFGIAFSN
KRWLHFFMLFVPVTGLWMSAIGMAGLAFNLRAYDFVSQEIRAAEDPEFET
FYTKNILLNEGLRAWLSEMDQPAKKFVFPDEVLPRGFS

3D structure

PDB

8eqm Structure of a dimeric photosystem II complex from a cyanobacterium acclimated to far-red light.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	D	H214 H268	H201 H255
BS02	CLA	D	V175 I178 F179 L182	V162 I165 F166 L169
BS03	PHO	D	L205 L209 I213 W253 F257	L192 L196 I200 W240 F244
BS04	BCT	D	H214 H268	H201 H255
BS05	CLA	D	I123 M126 I130	I110 M113 I117
BS06	CL7	D	M198 V201 T202	M185 V188 T189
BS07	PHO	D	S41 W48 G118 G121 L122 F125 Q129 N142 A145 F146 P149 Y153 F173 G174 V276 L279	S28 W35 G105 G108 L109 F112 Q116 N129 A132 F133 P136 Y140 F160 G161 V263 L266
BS08	CLA	D	P149 V152 T156 F181 L182 F185 Q186 Y191 T192 H197 G200 V201 S282 M286	P136 V139 T143 F168 L169 F172 Q173 Y178 T179 H184 G187 V188 S269 M273
BS09	CLA	D	C40 L43 L91 L92 W93 T112 F113 L116 H117 F120	C27 L30 L78 L79 W80 T99 F100 L103 H104 F107

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8eqm, PDBe:8eqm, PDBj:8eqm
PDBsum	8eqm
PubMed	36549647
UniProt	B4WKI3

[Back to BioLiP]