Structure of PDB 8el6 Chain D

Receptor sequence

>8el6D (length=162) Species: 464988 (Hemiselmis andersenii) [Search protein sequence]

AAYVGGADLQALKKFVSEGNKRMDSVNAIVSNASCIVSDSVSGMVCENPS
LIAPNGGVYTNRKMAACLRDAEIILRYVSYSLLSGDSSVLEDRCLNGLKE
TYASLGVPAAGNARTISIMKATVIGFITNNSQQKKLSTPAGDCSALASEV
GGYFDKVSSALA

3D structure

PDB

8el6 Molecular dissection of the soluble photosynthetic antenna from the cryptophyte alga Hemiselmis andersenii

Chain

Resolution

1.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	D	N76 R77	N61 R62
BS02	AX9	D	C50 D54 S57 G58 C61 R129 I133 A136 T137 F141 S146 Q148 K149	C35 D39 S42 G43 C46 R114 I118 A121 T122 F126 S131 Q133 K134
BS03	PEB	D	G72 V73 R77 K78 A81 C82 R84 D85 I88 Y92 L120 V122 N127	G57 V58 R62 K63 A66 C67 R69 D70 I73 Y77 L105 V107 N112
BS04	PEB	D	K28 N35 K36 M38 D39 I142 N144 T153 P154 A155 G156 C158	K13 N20 K21 M23 D24 I127 N129 T138 P139 A140 G141 C143
BS05	PEB	D	N76 R77	N61 R62

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8el6, PDBe:8el6, PDBj:8el6
PDBsum	8el6
PubMed	37957226
UniProt	U5T8W0\|PHEB_HEMAN Phycoerythrin beta subunit

[Back to BioLiP]