Structure of PDB 8el5 Chain D

Receptor sequence

>8el5D (length=174) Species: 464988 (Hemiselmis andersenii) [Search protein sequence]

AFSKVITSADGKAAYVGGADLQALKKFVSEGNKRMDSVNAIVSNASCIVS
DSVSGMVCENPSLIAPNGGVYTNRKMAACLRDAEIILRYVSYSLLSGDSS
VLEDRCLNGLKETYASLGVPAAGNARTISIMKATVIGFITNNSQQKKLST
PAGDCSALASEVGGYFDKVSSALA

3D structure

PDB

8el5 Molecular dissection of the soluble photosynthetic antenna from the cryptophyte alga Hemiselmis andersenii

Chain

Resolution

1.67 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	AX9	D	C50 D54 G58 C61 I133 A136 T137 F141 S146 Q148 K149	C47 D51 G55 C58 I130 A133 T134 F138 S143 Q145 K146
BS02	PEB	D	M59 G72 R77 K78 A81 C82 R84 D85 I88 L120 V122 P123 N127 T130	M56 G69 R74 K75 A78 C79 R81 D82 I85 L117 V119 P120 N124 T127
BS03	PEB	D	K28 N35 K36 M38 D39 I142 N144 T153 P154 A155 G156 C158	K25 N32 K33 M35 D36 I139 N141 T150 P151 A152 G153 C155

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8el5, PDBe:8el5, PDBj:8el5
PDBsum	8el5
PubMed	37957226
UniProt	U5T8W0\|PHEB_HEMAN Phycoerythrin beta subunit

[Back to BioLiP]