Structure of PDB 8dvx Chain D

Receptor sequence
>8dvxD (length=104) Species: 9823 (Sus scrofa) [Search protein sequence]
GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTD
ANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKK
ATNE
3D structure
PDB8dvx Cytochrome c lysine acetylation regulates cellular respiration and cell death in ischemic skeletal muscle.
ChainD
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 FC6 D K13 K87 E90 K13 K87 E90
BS02 HEC D K13 C14 C17 H18 T28 P30 T40 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82 K13 C14 C17 H18 T28 P30 T40 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
GO:0006915 apoptotic process
Cellular Component
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8dvx, PDBe:8dvx, PDBj:8dvx
PDBsum8dvx
PubMed37443314
UniProtP62895|CYC_PIG Cytochrome c (Gene Name=CYCS)

[Back to BioLiP]