Structure of PDB 8dvx Chain D

Receptor sequence

>8dvxD (length=104) Species: 9823 (Sus scrofa)

GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTD
ANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKK
ATNE

3D structure

• PDB: 8dvx Cytochrome c lysine acetylation regulates cellular respiration and cell death in ischemic skeletal muscle.
• Chain: D
• Resolution: 1.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FC6	D	K13 K87 E90	K13 K87 E90
BS02	HEC	D	K13 C14 C17 H18 T28 P30 T40 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82	K13 C14 C17 H18 T28 P30 T40 G41 Y48 T49 N52 W59 Y67 L68 T78 K79 M80 F82

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
• GO:0006915 apoptotic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:8dvx, PDBe:8dvx, PDBj:8dvx
• PDBsum: 8dvx
• PubMed: 37443314
• UniProt: P62895|CYC_PIG Cytochrome c (Gene Name=CYCS)