Structure of PDB 8csq Chain D

Receptor sequence

>8csqD (length=232) Species: 9606 (Homo sapiens) [Search protein sequence]

ERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFKSIRVLVAVG
NGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHDISLRF
KRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQG
LFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPE
DEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT

3D structure

PDB

8csq Principles of mitoribosomal small subunit assembly in eukaryotes.

Chain

Resolution

2.54 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	R191 S194 G195 N196 R226 V228 R242 F256 K260 K270 R274 R297 F298 K299 R300 R315 C316 H317 R318 Y333 A334 K335 S339 I340 N341 R351 R355 K405 W408 R419 S420 V421 W422 S423 R427	R2 S5 G6 N7 R37 V39 R44 F58 K62 K72 R76 R99 F100 K101 R102 R117 C118 H119 R120 Y135 A136 K137 S141 I142 N143 R153 R157 K207 W210 R221 S222 V223 W224 S225 R229

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8csq, PDBe:8csq, PDBj:8csq
PDBsum	8csq
PubMed	36482135
UniProt	P82675\|RT05_HUMAN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)

[Back to BioLiP]