Structure of PDB 8cf7 Chain D |
>8cf7D (length=89) Species: 305 (Ralstonia solanacearum) [Search protein sequence] |
SSVQTAATSWGTVPSIRVYTANNGRITERCWDGKGWYTGAFNEPGDNVSV TSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTRGAYTAT |
|
PDB | 8cf7 Cage versus sheet: Probing the Determinants of Protein - Cucurbit[7]uril Crystalline Architectures. |
Chain | D |
Resolution | 1.14 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
QQ7 |
D |
X34 G35 Y37 |
X34 G35 Y37 |
|
|
|
|