Structure of PDB 8ahq Chain D |
>8ahqD (length=78) Species: 1961 (Streptomyces virginiae) [Search protein sequence] |
DPAPVARALREELARTLYCEPGDIDDEASFNTLGLDSILGVEFVAFVNQT YGLDEKAGILYDHPSLAALSRHVAGRAA |
|
PDB | 8ahq Decrypting the programming of beta-methylation in virginiamycin M biosynthesis. |
Chain | D |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PNS |
D |
D6870 S6871 |
D36 S37 |
|
|
|
|