Structure of PDB 7zkn Chain D

Receptor sequence

>7zknD (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
G

3D structure

• PDB: 7zkn A terminal functionalization strategy reveals unusual binding abilities of anti-thrombin anticoagulant aptamers.
• Chain: D
• Resolution: 3.03 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	P60C W60D R221	P49 W50 R226
BS02	peptide	D	E23 G25 M26 W29 D116 H119 P120 C122 Y134 K135 G136 R137 N159 K186D K202 R206 W207	E8 G10 M11 W14 D113 H116 P117 C119 Y134 K135 G136 R137 N157 K189 K205 R211 W212
BS03	dna	D	I24 H71 T74 R75 Y76 E77 R77A N78 I79	I9 H66 T69 R70 Y71 E72 R73 N74 I75
BS04	dna	D	Y89 P92 R93 Y94 N95 W96 R97 W237 K240 Q244	Y85 P88 R89 Y90 N91 W92 R93 W242 K245 Q249
BS05	0G6	D	H57 Y60A W60D L99 D189 A190 C191 S195 S214 W215 G216	H43 Y47 W50 L96 D192 A193 C194 S198 S219 W220 G221

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:7zkn, PDBe:7zkn, PDBj:7zkn
• PDBsum: 7zkn
• PubMed: 36457701
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)