Structure of PDB 7yiy Chain D

Receptor sequence
>7yiyD (length=153) Species: 9606 (Homo sapiens) [Search protein sequence]
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWT
LTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRK
FLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGI
NKY
3D structure
PDB7yiy Ceramide sensing by human SPT-ORMDL complex for establishing sphingolipid homeostasis.
ChainD
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 Z1T D N13 F63 N13 F63
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0002903 negative regulation of B cell apoptotic process
GO:0006672 ceramide metabolic process
GO:0006686 sphingomyelin biosynthetic process
GO:0006940 regulation of smooth muscle contraction
GO:0010508 positive regulation of autophagy
GO:0030148 sphingolipid biosynthetic process
GO:0042552 myelination
GO:0044255 cellular lipid metabolic process
GO:0061744 motor behavior
GO:0090153 regulation of sphingolipid biosynthetic process
GO:0090156 intracellular sphingolipid homeostasis
GO:1900060 negative regulation of ceramide biosynthetic process
GO:1900182 positive regulation of protein localization to nucleus
GO:2000303 regulation of ceramide biosynthetic process
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0017059 serine palmitoyltransferase complex
GO:0030667 secretory granule membrane
GO:0035579 specific granule membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yiy, PDBe:7yiy, PDBj:7yiy
PDBsum7yiy
PubMed37308477
UniProtQ8N138|ORML3_HUMAN ORM1-like protein 3 (Gene Name=ORMDL3)

[Back to BioLiP]