Structure of PDB 7yiv Chain D

Receptor sequence
>7yivD (length=482) Species: 9606 (Homo sapiens) [Search protein sequence]
LVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTV
TAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAY
LCGVKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTT
RVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDV
IMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSH
FIWNRTELLTLDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAI
QILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGQAGSLTS
SEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGN
GPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPM
AHLLHGVHEQNYVPHVMAYAACIGANLGHCAP
3D structure
PDB7yiv The structural pathology for hypophosphatasia caused by malfunctional tissue non-specific alkaline phosphatase.
ChainD
Resolution3.18 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.3.1: alkaline phosphatase.
3.9.1.1: phosphoamidase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG D D60 H171 T173 E332 D43 H154 T156 E315
BS02 ZN D D337 H341 H454 D320 H324 H437
BS03 CA D E235 F290 E291 D306 E218 F273 E274 D289
BS04 ZN D D60 S110 D378 H379 D43 S93 D361 H362
Gene Ontology
Molecular Function
GO:0004035 alkaline phosphatase activity
GO:0004427 inorganic diphosphate phosphatase activity
GO:0005509 calcium ion binding
GO:0016462 pyrophosphatase activity
GO:0016787 hydrolase activity
GO:0016791 phosphatase activity
GO:0016887 ATP hydrolysis activity
GO:0033883 pyridoxal phosphatase activity
GO:0043262 ADP phosphatase activity
GO:0046872 metal ion binding
GO:0050187 phosphoamidase activity
GO:0052732 phosphoethanolamine phosphatase activity
Biological Process
GO:0001501 skeletal system development
GO:0001649 osteoblast differentiation
GO:0001958 endochondral ossification
GO:0003006 developmental process involved in reproduction
GO:0014070 response to organic cyclic compound
GO:0019725 cellular homeostasis
GO:0030282 bone mineralization
GO:0031214 biomineral tissue development
GO:0032496 response to lipopolysaccharide
GO:0032868 response to insulin
GO:0033280 response to vitamin D
GO:0034516 response to vitamin B6
GO:0036005 response to macrophage colony-stimulating factor
GO:0042822 pyridoxal phosphate metabolic process
GO:0046677 response to antibiotic
GO:0051384 response to glucocorticoid
GO:0055062 phosphate ion homeostasis
GO:0055074 calcium ion homeostasis
GO:0071407 cellular response to organic cyclic compound
GO:0071529 cementum mineralization
GO:0120162 positive regulation of cold-induced thermogenesis
GO:0140651 futile creatine cycle
GO:0140928 inhibition of non-skeletal tissue mineralization
GO:1904383 response to sodium phosphate
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0031012 extracellular matrix
GO:0031966 mitochondrial membrane
GO:0065010 extracellular membrane-bounded organelle
GO:0070062 extracellular exosome
GO:0098552 side of membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yiv, PDBe:7yiv, PDBj:7yiv
PDBsum7yiv
PubMed37422472
UniProtP05186|PPBT_HUMAN Alkaline phosphatase, tissue-nonspecific isozyme (Gene Name=ALPL)

[Back to BioLiP]