Structure of PDB 7xyg Chain D

Receptor sequence
>7xygD (length=95) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
3D structure
PDB7xyg Cryo-EM structure of Fft3-nucleosome complex with Fft3 bound to SHL+3 position of the nucleosome (Class II Fft3-nucleosome complex)
ChainD
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D K29 R30 K31 I36 Y37 K2 R3 K4 I9 Y10
BS02 dna D R28 R30 Y39 I51 S52 S53 R83 S84 R1 R3 Y12 I24 S25 S26 R56 S57
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xyg, PDBe:7xyg, PDBj:7xyg
PDBsum7xyg
PubMed
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]