Structure of PDB 7wnh Chain D

Receptor sequence

>7wnhD (length=316) Species: 9606 (Homo sapiens)

CAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRR
NRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPPVSLISALVRAHVDSN
PAMTSLDYSRFQANPSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADL
PKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNK
IVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLED
LVPPPAIIDKLFLDTL

3D structure

• PDB: 7wnh Integrative analysis reveals structural basis for transcription activation of Nurr1 and Nurr1-RXR alpha heterodimer.
• Chain: D
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	S366 V369 R370	S90 V93 R94
BS02	dna	D	C272 Q273 H274 Y275 V332 R334 G340 R342 G343 R344	C10 Q11 H12 Y13 V70 R72 G78 R80 G81 R82
BS03	dna	D	E281 R289 R312 N313 Q316 R319 R341 R342 G343 R344 P346	E19 R27 R50 N51 Q54 R57 R79 R80 G81 R82 P84
BS04	ZN	D	C263 C266 C280 C283	C1 C4 C18 C21
BS05	ZN	D	C305 C318	C43 C56

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0004879 nuclear receptor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7wnh, PDBe:7wnh, PDBj:7wnh
• PDBsum: 7wnh
• PubMed: 36442107
• UniProt: P43354|NR4A2_HUMAN Nuclear receptor subfamily 4 group A member 2 (Gene Name=NR4A2)