Structure of PDB 7wm3 Chain D

Receptor sequence

>7wm3D (length=179) Species: 9606 (Homo sapiens) [Search protein sequence]

REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGF
GFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKL
FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHD
PVDKIVLQKYHTINGHNAEVRKALSRQEM

3D structure

PDB

7wm3 Structural Insight Into hnRNP A2/B1 Homodimerization and DNA Recognition.

Chain

Resolution

1.62 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	D	K113 F115 G117 G118 R147 R153 F155 F157 E183 R185 R190 Q191 M193	K99 F101 G103 G104 R133 R139 F141 F143 E169 R171 R176 Q177 M179
BS02	dna	D	K17 E18 Y174 N181	K3 E4 Y160 N167
BS03	dna	D	E18 K22 F24 G26 G27 L28 S29 F30 D49 V51 M53 R60 S61 R62 F64 F66 R89 E92 K94 A96 V97 R99 H108	E4 K8 F10 G12 G13 L14 S15 F16 D35 V37 M39 R46 S47 R48 F50 F52 R75 E78 K80 A82 V83 R85 H94

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:7wm3, PDBe:7wm3, PDBj:7wm3
PDBsum	7wm3
PubMed	36528084
UniProt	P22626\|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (Gene Name=HNRNPA2B1)

[Back to BioLiP]