Structure of PDB 7vxq Chain D

Receptor sequence

>7vxqD (length=268) Species: 1080067 (Citrobacter sp. S-77)

PQRPPVIWIGAQECTGCTESLLRATHPTVENLVLETISLEYHEVLSAAFG
HQVEENKHNALEKYKGQYVLVVDGSIPLKDNGIYCMVAGEPIVDHIRRAA
EGAAAIIAIGSCAAWGGVAAAGVNPTGAVGLQEVLPGKTIINIPGCPPNP
HNFLATVAHIITYGKPPKLDAKNRPTFAYGRLIHEHCERRPHFDAGRFAK
EFGDEGHREGWCLYHLGCKGPETYGNCSTLQFCDVGGVWPVAIGHPCYGC
NEEGIGFHKGIHQLAHVE

3D structure

• PDB: 7vxq Structural and spectroscopic characterization of CO inhibition of [NiFe]-hydrogenase from Citrobacter sp. S-77.
• Chain: D
• Resolution: 1.77 Å

Enzymatic activity

• Enzyme Commision number: 1.12.99.6: hydrogenase (acceptor).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	D	H192 C195 R197 R198 C220 L221 Y222 C226 P229	H184 C187 R189 R190 C212 L213 Y214 C218 P221
BS02	F3S	D	I191 C235 F240 P248 C255 Y256 G257 C258 N259	I183 C227 F232 P240 C247 Y248 G249 C250 N251
BS03	SF4	D	E21 C22 G24 C25 G118 C120 C154 P155	E13 C14 G16 C17 G110 C112 C146 P147

Gene Ontology

Molecular Function

• GO:0008901 ferredoxin hydrogenase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0033748 hydrogenase (acceptor) activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0009375 ferredoxin hydrogenase complex
• GO:0016020 membrane
• GO:0044569 [Ni-Fe] hydrogenase complex

External links

• PDB: RCSB:7vxq, PDBe:7vxq, PDBj:7vxq
• PDBsum: 7vxq
• PubMed: 35102895
• UniProt: A0A3B6UEQ0