Structure of PDB 7vuu Chain D

Receptor sequence
>7vuuD (length=65) Species: 9606 (Homo sapiens) [Search protein sequence]
EEELREQFRVEDKDGNGYISAAELRIVMTNRGEPLTDEEVDELHRETDID
GDGQVNYEEFVQRMR
3D structure
PDB7vuu NMR-guided directed evolution.
ChainD
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 3NY D E17 L30 M34 R37 L49 T53 V61 R69 M70 E11 L24 M28 R31 L43 T47 V55 R63 M64
BS02 CA D D18 D20 N22 Y24 E29 D12 D14 N16 Y18 E23
BS03 CA D D54 D56 D58 Q60 E65 D48 D50 D52 Q54 E59
BS04 CA D E8 E12 E2 E6
BS05 CA D R51 D54 R45 D48
BS06 CA D R15 D18 R9 D12
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:7vuu, PDBe:7vuu, PDBj:7vuu
PDBsum7vuu
PubMed36198791
UniProtP0DP23|CALM1_HUMAN Calmodulin-1 (Gene Name=CALM1)

[Back to BioLiP]