Structure of PDB 7vd5 Chain D

Receptor sequence

>7vd5D (length=341) [Search protein sequence]

RGLFDLVDDWLKKDRFVFVGWSGLLLFPTAYLAAGGWMTGTTFVTSWYTH
GLASSYLEGCNFLTAAVSTPANSVGHSLLLLWGPEAQGDFTRWCQIGGLW
TFVALHGAFGLIGFCLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLLYP
LGQASWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLC
AIHGATVENTLFEDGDAANTFRAFTPTQSEETYSMVTANRFWSQIFGVAF
SNKRWLHFFMLFVPVTGLWTSSIGIVGLALNLRAYDFVSQELRAAEDPEF
ETFYTKNHLLDEGIRAWMAAQDQPHENFVFPEEVLPRGNAL

3D structure

PDB

7vd5 Structural basis for different types of hetero-tetrameric light-harvesting complexes in a diatom PSII-FCPII supercomplex

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	D	Y41 M48 T52 F53 Y66 L67	Y31 M38 T42 F43 Y56 L57
BS02	FE2	D	H213 H267	H203 H257
BS03	PHO	D	A40 W47 G120 L121 F124 Q128 N141 F145 P148 F152 F172 G173 P274 L278	A30 W37 G110 L111 F114 Q118 N131 F135 P138 F142 F162 G163 P264 L268
BS04	BCT	D	H213 Y243 K263 H267	H203 Y233 K253 H257
BS05	CLA	D	F119 I122 C125 L126 F129	F109 I112 C115 L116 F119
BS06	CLA	D	M197 V200 A201	M187 V190 A191
BS07	CLA	D	F156 I177 F178 L181	F146 I167 F168 L171
BS08	PHO	D	L204 L208 I212 W252 F256	L194 L198 I202 W242 F246
BS09	CLA	D	P148 V151 V155 F180 L181 L184 Q185 W190 T191 H196 G199 V200 L204 S281 S282	P138 V141 V145 F170 L171 L174 Q175 W180 T181 H186 G189 V190 L194 S271 S272
BS10	CLA	D	T39 L42 L90 L91 W92 T111 F112 H116 F119	T29 L32 L80 L81 W82 T101 F102 H106 F109

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7vd5, PDBe:7vd5, PDBj:7vd5
PDBsum	7vd5
PubMed
UniProt	A0A679C012

[Back to BioLiP]