Structure of PDB 7ux9 Chain D |
>7ux9D (length=96) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
KMKKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASES SKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS |
|
PDB | 7ux9 Chromatin remodeling of histone H3 variants by DDM1 underlies epigenetic inheritance of DNA methylation. |
Chain | D |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
D |
S81 K111 P112 |
S29 K59 P60 |
|
|
|
|