Structure of PDB 7uqz Chain D

Receptor sequence

>7uqzD (length=270) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

AKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFT
NKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIA
RRTLQKLGLDEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGAS
DGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEE
RFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKPTEKKFTKEQYAA
ESKKYRQTKLSKEERAARVA

3D structure

PDB

7uqz rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.

Chain

Resolution

2.44 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	Y12 F16 Q17 P19 R23 G26 Y31 R35 L36 Q39 H40 K41 K48 F145 L146 I148 L150 R152 T153 P174 H175 S176 N178 R179	Y6 F10 Q11 P13 R17 G20 Y25 R29 L30 Q33 H34 K35 K42 F128 L129 I131 L133 R135 T136 P157 H158 S159 N161 R162
BS02	rna	D	K8 S10 S13 S14 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 K58 I61 Q63 I65 D72 V73 V74 Y79 H90 G91 N94 W95 R152 T154 T155 G156 A157 R158 Y198 H203 Y207 R218 E221 L222 F223 K224 F253 P255 T256 K259 F260 K262 Q264 Y265 A266 E268 S269 K270 Y272 R273 Q274 K276 K279 R282 R285	K2 S4 S7 S8 T12 F14 R15 R16 R18 K21 T22 Y24 R27 R44 R48 T50 N51 K52 I55 Q57 I59 D66 V67 V68 Y73 H84 G85 N88 W89 R135 T137 T138 G139 A140 R141 Y181 H186 Y190 R201 E204 L205 F206 K207 F236 P238 T239 K242 F243 K245 Q247 Y248 A249 E251 S252 K253 Y255 R256 Q257 K259 K262 R265 R268

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7uqz, PDBe:7uqz, PDBj:7uqz
PDBsum	7uqz
PubMed	36864048
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]