Structure of PDB 7unv Chain D

Receptor sequence

>7unvD (length=211) Species: 208964 (Pseudomonas aeruginosa PAO1)

MTIGVVGRKCGMTRIFTEEGVSIPVTVIEVEPNRVTQFKTEETDGYRAVQ
VTAGERRASRVTKAQAGHFAKANVAAGRGVWEFRLGEEQYAAGDQITVDL
FQAGQMVDVTGESKGKGFAGTIKRWNFRGQDNTHGNSVSHRVPGSIGQCQ
TPGRVFKGKKMSGHLGAERVTVQSLEIVRVDAERNLLLVKGAVPGATGGD
VIVRPAAKARG

3D structure

• PDB: 7unv Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
• Chain: D
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	M12 R14 D44 Y46 R56 R57 R60 T62 K63 A64 G67 H68 K71 V80 E82 R84 S113 K114 G115 K116 G117 F118 G120 K123 R124 F127 R128 Q130 N132 T133 H134 G135 N136 S137 V138 S139 H140 R141 P143 G144 S145 I146 G147 Q148 C149 Q150 T151 P152 G153 R154 V155 K157 G158 K159 M161 H164 R169 T171 Q173 V193 P194 G195 A196 T197 K208	M12 R14 D44 Y46 R56 R57 R60 T62 K63 A64 G67 H68 K71 V80 E82 R84 S113 K114 G115 K116 G117 F118 G120 K123 R124 F127 R128 Q130 N132 T133 H134 G135 N136 S137 V138 S139 H140 R141 P143 G144 S145 I146 G147 Q148 C149 Q150 T151 P152 G153 R154 V155 K157 G158 K159 M161 H164 R169 T171 Q173 V193 P194 G195 A196 T197 K208
BS02	MG	D	K159 K160	K159 K160
BS03	MG	D	S113 K114	S113 K114

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7unv, PDBe:7unv, PDBj:7unv
• PDBsum: 7unv
• UniProt: Q9HWD5|RL3_PSEAE Large ribosomal subunit protein uL3 (Gene Name=rplC)