Structure of PDB 7ttw Chain D

Receptor sequence
>7ttwD (length=100) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGA
PTVEGATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKI
3D structure
PDB7ttw A Structurally Characterized Staphylococcus aureus Evolutionary Escape Route from Treatment with the Antibiotic Linezolid.
ChainD
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D K10 F21 K24 Y76 K77 R78 R79 K80 K83 R84 K86 G87 H88 R89 K10 F21 K24 Y76 K77 R78 R79 K80 K83 R84 K86 G87 H88 R89
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ttw, PDBe:7ttw, PDBj:7ttw
PDBsum7ttw
PubMed35736238
UniProtQ2FXS8|RL21_STAA8 Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]