Structure of PDB 7spd Chain D |
>7spdD (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] |
SHMCSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDD YSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGID EIYLESC |
|
PDB | 7spd Pentameric assembly of the Kv2.1 tetramerization domain. |
Chain | D |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
H105 C132 |
H80 C107 |
|
BS02 |
ZN |
D |
H27 C29 |
H2 C4 |
|
|
|
|