Structure of PDB 7rsz Chain D

Receptor sequence
>7rszD (length=335) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]
KTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEMVLANVTENFNMWKN
DMVEQMHEDIISLWDESLKPCVKLTGGSAITQACPKVSFDPIPLHYCAPA
GFAILKCNNKTFNGTGPCRNVSTVQCTHGIKPVVSTQLLLNGSLAEEEII
IRSENLTNNAKTIIVHLNESVNIVCTRPNNIRQAHCNINESKWNNTLQKV
GEELAKHFPSKTIKFEPSSGGDLEITTHSFNCRGEFFYCNTSDLFNGTYR
NGTYNHTGRSSNGTITLQCKIKQIINMWQEVGRAIYAPPIEGEITCNSNI
TGLLLLRDDTETFRPGGGDMRDNWRSELYKYKVVE
3D structure
PDB7rsz Identification of gp120 Residue His105 as a Novel Target for HIV-1 Neutralization by Small-Molecule CD4-Mimics.
ChainD
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 7IW D H105 T257 E370 S375 F376 I424 N425 M426 W427 G473 M475 H57 T136 E224 S229 F230 I275 N276 M277 W278 G318 M320
BS02 7IT D H105 V255 S256 T257 E370 S375 F376 I424 N425 M426 W427 G473 D474 M475 H57 V134 S135 T136 E224 S229 F230 I275 N276 M277 W278 G318 D319 M320
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 11:52:53 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7rsz', asym_id = 'D', title = 'Identification of gp120 Residue His105 as a Nove...IV-1 Neutralization by Small-Molecule CD4-Mimics.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7rsz', asym_id='D', title='Identification of gp120 Residue His105 as a Nove...IV-1 Neutralization by Small-Molecule CD4-Mimics.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0019031', uniprot = '', pdbid = '7rsz', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0019031', uniprot='', pdbid='7rsz', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>