Structure of PDB 7rne Chain D |
>7rneD (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] |
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMH ILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY |
|
PDB | 7rne Structure-Based Design and Biological Evaluation of Novel Caspase-2 Inhibitors Based on the Peptide AcVDVAD-CHO and the Caspase-2-Mediated Tau Cleavage Sequence YKPVD314. |
Chain | D |
Resolution | 2.73 Å |
3D structure |
|
|
Enzyme Commision number |
3.4.22.56: caspase-3. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
D |
Y204 S205 R207 |
Y20 S21 R23 |
|
|
|
|