Structure of PDB 7rlk Chain D |
>7rlkD (length=117) Species: 9315 (Notamacropus eugenii) [Search protein sequence] |
CPLMVKVLDAVRGRPAVNVDVKVFKKTEEQTWELFAAGKTNDNGEIHELT TDDKFGEGLYKVEFDTISYWKALGVSPFHEYADVVFTANDAGHRHYTIAA LLSPYSFSTTAIVSNPT |
|
PDB | 7rlk Structural and amyloidogenic comparisons of human and wallaby transthyretins: implications for amyloidosis? |
Chain | D |
Resolution | 2.69 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
D61 H102 H104 |
D52 H93 H95 |
|
|
|
|