Structure of PDB 7r63 Chain D |
>7r63D (length=130) Species: 9844 (Lama glama) [Search protein sequence] |
QVQLQESGGGLVQTGGSLRLSCKASGRAFARYDLAWSRQAPGKQREFVAS IGVTRNPPYYSGSVKGRFTVSRDNAKETVYLQMNDLKPEDSAVYYCAAKD ASVTVATIEDYPYWGRGTQVTVSSENLYFQ |
|
PDB | 7r63 Development of high-affinity nanobodies specific for Na V 1.4 and Na V 1.5 voltage-gated sodium channel isoforms. |
Chain | D |
Resolution | 2.0 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NA |
D |
G8 L18 R19 |
G8 L18 R19 |
|
|
|