Structure of PDB 7quj Chain D

Receptor sequence

>7qujD (length=257) Species: 180189 (Nepeta sibirica)

KLEGKVAIVTGGASGIGETAARIFADHGARAVVIADIQSELGRMVAESIG
AKRCSYVQCDIADEEQVKSAVEWTATTYGGLDVMFCNAGIMSHSDSGQTV
MELDMSKFDEVMRVNTRGTAACVKQAARKMVELGTRGGAIICTSSPLATR
GGHVDTDYVMSKHAVLGLVRSASMQLGAHGIRVNSVSPMAVLTPLTRRMG
LATPADVENALGRFTSLKGVALTAEHVAEAAAFLASDEAAFITGHDLVVD
GGLLCLP

3D structure

• PDB: 7quj Biocatalytic routes to stereo-divergent iridoids.
• Chain: D
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	D	G34 S37 G38 I39 D59 I60 Q61 C82 D83 I84 N110 A111 G112 T166 Y181 K185 P211 M212 A213 V214 T216 P217 L218 T219	G11 S14 G15 I16 D36 I37 Q38 C59 D60 I61 N87 A88 G89 T143 Y158 K162 P188 M189 A190 V191 T193 P194 L195 T196

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 22:31:11 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7quj', asym_id = 'D', title = 'Biocatalytic routes to stereo-divergent iridoids.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7quj', asym_id='D', title='Biocatalytic routes to stereo-divergent iridoids.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '7quj', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='7quj', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>