Structure of PDB 7qsz Chain D

Receptor sequence

>7qszD (length=450) Species: 32630 (synthetic construct)

YEAGVRPYRETYYDPDYEPKDTDLLCAFRITPKPGVPMEEAAAAVAAESS
TGTWTEVWSNLLTDLERYKARCYRIEGDVAYIAYPLDLFEEGSIVNIMSS
IVGNVFGFKAVQALRLEDMRIPVAYLKTFPGPPTGIQVERDRLNKYGRPL
LGGTIKPKLGLSAKNYARVVYECLRGGLDTTKDDENLNSQPFNRWRDRFL
YVMEAVRKAEAETGERKGHWLNVTAGSTEEMLKRAEFAAELGSRYIMVDF
LTAGFAAFASVRRRAEELGLMLHCHRAMHAVFDRQPNHGIHFRVLAKWLR
MVGGDHVHTGTVVGKLEGDRAETLGIADLLREDYVPADPGRGLFFDQDWA
GLKPVFPVASGGIHVWHVPDLVSIFGDDAFFLFGGGTHGHPRGSRAGATA
NRVAVEAVVQARNEGRDILAEGREILEEAARSCPELREAMELWGDVKFEV

3D structure

• PDB: 7qsz Evolution of increased complexity and specificity at the dawn of form I Rubiscos.
• Chain: D
• Resolution: 2.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CAP	D	T159 K161 K187 D189 E190 H280 R281 H313 K320 L321 S365 G366 G389 G390	T154 K156 K182 D184 E185 H275 R276 H308 K315 L316 S360 G361 G384 G385
BS02	MG	D	K187 D189 E190	K182 D184 E185

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 04:43:50 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7qsz', asym_id = 'D', title = 'Evolution of increased complexity and specificity at the dawn of form I Rubiscos.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7qsz', asym_id='D', title='Evolution of increased complexity and specificity at the dawn of form I Rubiscos.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000287,0015977,0016984', uniprot = '', pdbid = '7qsz', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000287,0015977,0016984', uniprot='', pdbid='7qsz', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>