Structure of PDB 7qi5 Chain D

Receptor sequence

>7qi5D (length=238) Species: 9606 (Homo sapiens) [Search protein sequence]

ANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFL
RFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAG
DTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAA
GTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKA
GRNRWLGKRPNSGRWHRKGGWAGRKIRPLPPMKSYVKL

3D structure

PDB

7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.

Chain

Resolution

2.63 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	N62 F63 W66 K67 R69 K71 I74 T75 K78 R80 K81 S82 G83 G84 R85 H87 G89 R90 I91 R92 V93 G97 G98 H100 K101 Q102 R103 Y104 R105 Q128 Y131 P133 R135 L141 R202 Q205 Y206 I207 R208 A209 A210 G211 L228 P229 S230 R246 V250 H252 N253 I257 G258 K259 A260 G261 R262 N263 R264 W265 R269 P270 N271 G273 R274 W275 H276 R277 K278 G279 G280 W281 A282 G283 R284 K285 R287 K293 Y295	N2 F3 W6 K7 R9 K11 I14 T15 K18 R20 K21 S22 G23 G24 R25 H27 G29 R30 I31 R32 V33 G37 G38 H40 K41 Q42 R43 Y44 R45 Q68 Y71 P73 R75 L81 R142 Q145 Y146 I147 R148 A149 A150 G151 L168 P169 S170 R186 V190 H192 N193 I197 G198 K199 A200 G201 R202 N203 R204 W205 R209 P210 N211 G213 R214 W215 H216 R217 K218 G219 G220 W221 A222 G223 R224 K225 R227 K233 Y235

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005654	nucleoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
PDBsum	7qi5
PubMed	38769321
UniProt	Q5T653\|RM02_HUMAN Large ribosomal subunit protein uL2m (Gene Name=MRPL2)

[Back to BioLiP]