Structure of PDB 7pnx Chain D

Receptor sequence

>7pnxD (length=343) Species: 9606 (Homo sapiens)

SFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRY
GFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKV
KRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGR
KKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYED
HTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVS
GSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASP
RGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT

3D structure

• PDB: 7pnx Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
• Chain: D
• Resolution: 2.76 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	T91 L98 K100 G101 A104 T106 A108 G109 K112 R114 K116 T118 K121 R136 R191 S194 G195 N196 R226 M231 A233 R237 R242 F256 I258 K260 D266 R269 K270 F298 K299 R300 R315 C316 H317 R318 Y333 A334 K335 S339 I340 L343 Q347 R351 R355 K405 W408 K418 R419 S420 V421 W422 S423 R427	T4 L11 K13 G14 A17 T19 A21 G22 K25 R27 K29 T31 K34 R49 R104 S107 G108 N109 R139 M144 A146 R150 R155 F169 I171 K173 D179 R182 K183 F211 K212 R213 R228 C229 H230 R231 Y246 A247 K248 S252 I253 L256 Q260 R264 R268 K318 W321 K331 R332 S333 V334 W335 S336 R340

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pnx, PDBe:7pnx, PDBj:7pnx
• PDBsum: 7pnx
• PubMed: 35676484
• UniProt: P82675|RT05_HUMAN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)