Structure of PDB 7ph7 Chain D |
>7ph7D (length=113) Species: 30538 (Vicugna pacos) [Search protein sequence] |
QMQLVESGGGLVQAGGSLRLSCAVSGSIFSIITLAWYRQAPGKPRENVAT ITRGSRTSYADSVKGRFCISKDNAKSTVYLQMNKLKPEDTADYYCNAEGP AGYWGQGTPVTVS |
|
PDB | 7ph7 The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells. |
Chain | D |
Resolution | 4.1 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
88T |
D |
F67 C68 |
F67 C68 |
|
|
|