Structure of PDB 7p2e Chain D

Receptor sequence

>7p2eD (length=337) Species: 9606 (Homo sapiens)

SFFTKLTADELWKGALAETGAGAKKGRKKRKDLNRGQIIGEGRYGFLWPG
LNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKVKRERGW
SGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKSIRV
LVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHD
ISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINML
SLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRK
DPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT

3D structure

• PDB: 7p2e Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
• Chain: D
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	T91 K100 G101 A104 T106 G109 K112 R114 R136 R191 S194 G195 N196 R226 F229 T230 M231 A233 K234 E235 R237 R242 F256 K260 R269 R297 F298 K299 R300 R315 C316 H317 R318 Y333 A334 K335 S339 I340 L343 Q347 R351 W408 K418 R419 S420 V421 W422 S423 R427	T4 K13 G14 A17 T19 G22 K25 R27 R43 R98 S101 G102 N103 R133 F136 T137 M138 A140 K141 E142 R144 R149 F163 K167 R176 R204 F205 K206 R207 R222 C223 H224 R225 Y240 A241 K242 S246 I247 L250 Q254 R258 W315 K325 R326 S327 V328 W329 S330 R334

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7p2e, PDBe:7p2e, PDBj:7p2e
• PDBsum: 7p2e
• PubMed: 36480258
• UniProt: P82675|RT05_HUMAN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)