Structure of PDB 7ok7 Chain D

Receptor sequence

>7ok7D (length=177) Species: 10090 (Mus musculus) [Search protein sequence]

SILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIK
SVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETG
QELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQ
IQSCSALTGEGVQDGMNWVCKNVNAKK

3D structure

PDB

7ok7 The Structural and Biochemical Characterization of UNC119B Cargo Binding and Release Mechanisms.

Chain

Resolution

3.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	D	D26 N27 A28 G29 K30 T31 T32 P47 T48 G69 G70 N126 K127 D129 S159 L161	D22 N23 A24 G25 K26 T27 T28 P43 T44 G65 G66 N122 K123 D125 S155 L157
BS02	MG	D	T31 T48	T27 T44

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0008017	microtubule binding
GO:0019003	GDP binding
GO:0046872	metal ion binding

	Biological Process
GO:0000281	mitotic cytokinesis
GO:0001822	kidney development
GO:0006892	post-Golgi vesicle-mediated transport
GO:0006893	Golgi to plasma membrane transport
GO:0007224	smoothened signaling pathway
GO:0007264	small GTPase-mediated signal transduction
GO:0015031	protein transport
GO:0042073	intraciliary transport
GO:0042461	photoreceptor cell development
GO:0051301	cell division
GO:0060271	cilium assembly
GO:0061512	protein localization to cilium
GO:1903441	protein localization to ciliary membrane

	Cellular Component
GO:0000139	Golgi membrane
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005794	Golgi apparatus
GO:0005813	centrosome
GO:0005819	spindle
GO:0005856	cytoskeleton
GO:0005876	spindle microtubule
GO:0005881	cytoplasmic microtubule
GO:0005929	cilium
GO:0005930	axoneme
GO:0016020	membrane
GO:0030496	midbody
GO:0032391	photoreceptor connecting cilium
GO:0035869	ciliary transition zone
GO:0036064	ciliary basal body
GO:0042995	cell projection

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ok7, PDBe:7ok7, PDBj:7ok7
PDBsum	7ok7
PubMed	34130453
UniProt	Q9WUL7\|ARL3_MOUSE ADP-ribosylation factor-like protein 3 (Gene Name=Arl3)

[Back to BioLiP]