Structure of PDB 7ods Chain D

Receptor sequence

>7odsD (length=240) Species: 9606 (Homo sapiens)

ANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFL
RFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAG
DTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAA
GTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKA
GRNRWLGKRPNSGRWHRKGGWAGRKIRPLPPMKSYVKLPS

3D structure

• PDB: 7ods Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
• Chain: D
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	N62 W66 K67 R69 K71 I74 T75 R80 K81 S82 R85 H87 G89 R90 I91 R92 V93 H94 I96 G98 H100 K101 Q102 R103 Y104 R105 I127 Q128 Y131 P133 R135 L141 R202 Q205 Y206 R208 A209 A210 G211 T212 L228 P229 S230 R232 R246 V250 N253 I257 G258 K259 A260 G261 R262 N263 R264 W265 R269 P270 N271 G273 R274 W275 H276 W281 K285 R287 K293 K297	N2 W6 K7 R9 K11 I14 T15 R20 K21 S22 R25 H27 G29 R30 I31 R32 V33 H34 I36 G38 H40 K41 Q42 R43 Y44 R45 I67 Q68 Y71 P73 R75 L81 R142 Q145 Y146 R148 A149 A150 G151 T152 L168 P169 S170 R172 R186 V190 N193 I197 G198 K199 A200 G201 R202 N203 R204 W205 R209 P210 N211 G213 R214 W215 H216 W221 K225 R227 K233 K237
BS02	MG	D	Y131 S136	Y71 S76

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ods, PDBe:7ods, PDBj:7ods
• PDBsum: 7ods
• PubMed: 34135320
• UniProt: Q5T653|RM02_HUMAN Large ribosomal subunit protein uL2m (Gene Name=MRPL2)