Structure of PDB 7od8 Chain D |
>7od8D (length=144) Species: 490133 (Hepatitis B virus ayw/France/Tiollais/1979) [Search protein sequence] |
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP HHTALRQAIVCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLP |
|
PDB | 7od8 Conformational Plasticity of Hepatitis B Core Protein Spikes Promotes Peptide Binding Independent of the Secretion Phenotype. |
Chain | D |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
D |
N75 L76 E77 S81 |
N75 L76 E77 S81 |
|
|
|
|