Structure of PDB 7ntu Chain D

Receptor sequence

>7ntuD (length=249) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

• PDB: 7ntu Structural and functional analysis of the simultaneous binding of two duplex/quadruplex aptamers to human alpha-thrombin.
• Chain: D
• Resolution: 3.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 E192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H43 D99 E194 G195 D196 S197 G198
• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	E23 G25 M26 W29 D116 H119 P120 C122 Y134 K135 R137 N159 K186D K202 R206 W207	E8 G10 M11 W14 D113 H116 P117 C119 Y134 K135 R137 N156 K188 K204 R210 W211
BS02	dna	D	R75 Y76 E77 R77A N78 I79 Y117	R70 Y71 E72 R73 N74 I75 Y114
BS03	dna	D	Y89 P92 R93 Y94 N95 W96 R97 R101 R126 L130 R165 K169 H230 R233 W237 Q244	Y85 P88 R89 Y90 N91 W92 R93 R98 R123 L130 R162 K166 H234 R237 W241 Q248
BS04	0G6	D	H57 Y60A L99 I174 D189 A190 S195 S214 W215 G216	H43 Y47 L96 I171 D191 A192 S197 S218 W219 G220

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:7ntu, PDBe:7ntu, PDBj:7ntu
• PDBsum: 7ntu
• PubMed: 33864869
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)