Structure of PDB 7nhq Chain D
Receptor sequence
| >7nhqD (length=341) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] |
| RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTH GLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLW TFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYP LGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLC AIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAF SNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEF ETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL |
3D structure
| PDB | 7nhq Structural insights into photosystem II assembly. | ||
| Chain | D | ||
| Resolution | 2.68 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | 1.10.3.9: photosystem II. |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | FE | D | H214 E241 H268 | H203 E230 H257 | |
| BS02 | PHO | D | L209 I213 W253 | L198 I202 W242 | |
| BS03 | CLA | D | M126 L127 | M115 L116 | |
| BS04 | CLA | D | M198 V201 A202 | M187 V190 A191 | |
| BS05 | CLA | D | F157 V175 F179 | F146 V164 F168 | |
| BS06 | PHO | D | A41 W48 L122 F125 F146 P149 L279 | A30 W37 L111 F114 F135 P138 L268 | |
| BS07 | CLA | D | V152 V156 F181 L182 W191 H197 G200 V201 V204 S282 A283 | V141 V145 F170 L171 W180 H186 G189 V190 V193 S271 A272 | |
| BS08 | CLA | D | C40 L43 W93 F113 H117 F120 | C29 L32 W82 F102 H106 F109 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0005506 | iron ion binding |
| GO:0009055 | electron transfer activity |
| GO:0010242 | oxygen evolving activity |
| GO:0016168 | chlorophyll binding |
| GO:0016491 | oxidoreductase activity |
| GO:0045156 | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity |
| GO:0046872 | metal ion binding |
