Structure of PDB 7mid Chain D

Receptor sequence

>7midD (length=91) Species: 243231 (Geobacter sulfurreducens PCA)

MEHLYIVSYDIRNQRRWRRLFKTMHGFGCWLQLSVFQCRLDRIRIIKMEA
AINEIVNHAEDHVLILDLGPAENVKPKVSSIGKTFDPILRQ

3D structure

• PDB: 7mid Mechanism for Cas4-assisted directional spacer acquisition in CRISPR-Cas.
• Chain: D
• Resolution: 3.56 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	Y9 D10 I11 R12 Q14 W17 F21 L33	Y9 D10 I11 R12 Q14 W17 F21 L33
BS02	MN	D	Y9 D10 S34	Y9 D10 S34

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0004519 endonuclease activity
• GO:0004521 RNA endonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008150 biological_process
• GO:0043571 maintenance of CRISPR repeat elements
• GO:0051607 defense response to virus

External links

• PDB: RCSB:7mid, PDBe:7mid, PDBj:7mid
• PDBsum: 7mid
• PubMed: 34588691
• UniProt: Q74H35|CAS2_GEOSL CRISPR-associated endoribonuclease Cas2 (Gene Name=cas2)