Structure of PDB 7kw7 Chain D

Receptor sequence

>7kw7D (length=379) Species: 9606 (Homo sapiens) [Search protein sequence]

AAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD
AAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKV
QVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDS
QRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGG
TFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDI
SQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFE
ELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDF
FNGRDLNKSINPDEAVAYGAAVQAAILMG

3D structure

PDB

7kw7 Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.

Chain

Resolution

3.57 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	D	Y15 E175 G201 G202 E268 S275 G338 G339 R342	Y12 E172 G198 G199 E265 S272 G335 G336 R339
BS02	MG	D	E175 D199	E172 D196

Gene Ontology

	Molecular Function
GO:0001618	virus receptor activity
GO:0001664	G protein-coupled receptor binding
GO:0003714	transcription corepressor activity
GO:0003723	RNA binding
GO:0005102	signaling receptor binding
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity
GO:0019899	enzyme binding
GO:0031072	heat shock protein binding
GO:0031249	denatured protein binding
GO:0031625	ubiquitin protein ligase binding
GO:0038177	death receptor agonist activity
GO:0042826	histone deacetylase binding
GO:0044183	protein folding chaperone
GO:0045296	cadherin binding
GO:0048018	receptor ligand activity
GO:0051082	unfolded protein binding
GO:0051787	misfolded protein binding
GO:0055131	C3HC4-type RING finger domain binding
GO:0097718	disordered domain specific binding
GO:0140416	transcription regulator inhibitor activity
GO:0140545	ATP-dependent protein disaggregase activity
GO:0140662	ATP-dependent protein folding chaperone

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006402	mRNA catabolic process
GO:0006986	response to unfolded protein
GO:0007041	lysosomal transport
GO:0007165	signal transduction
GO:0008285	negative regulation of cell population proliferation
GO:0010628	positive regulation of gene expression
GO:0030308	negative regulation of cell growth
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0031396	regulation of protein ubiquitination
GO:0031397	negative regulation of protein ubiquitination
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032757	positive regulation of interleukin-8 production
GO:0033120	positive regulation of RNA splicing
GO:0034599	cellular response to oxidative stress
GO:0034605	cellular response to heat
GO:0034620	cellular response to unfolded protein
GO:0042026	protein refolding
GO:0043066	negative regulation of apoptotic process
GO:0045648	positive regulation of erythrocyte differentiation
GO:0046034	ATP metabolic process
GO:0046718	symbiont entry into host cell
GO:0050821	protein stabilization
GO:0051085	chaperone cofactor-dependent protein refolding
GO:0051092	positive regulation of NF-kappaB transcription factor activity
GO:0051131	chaperone-mediated protein complex assembly
GO:0070370	cellular heat acclimation
GO:0070434	positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway
GO:0071383	cellular response to steroid hormone stimulus
GO:0090063	positive regulation of microtubule nucleation
GO:0090084	negative regulation of inclusion body assembly
GO:1901029	negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
GO:1901673	regulation of mitotic spindle assembly
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1902380	positive regulation of endoribonuclease activity
GO:1903265	positive regulation of tumor necrosis factor-mediated signaling pathway
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005783	endoplasmic reticulum
GO:0005813	centrosome
GO:0005814	centriole
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005925	focal adhesion
GO:0008180	COP9 signalosome
GO:0016234	inclusion body
GO:0016235	aggresome
GO:0016607	nuclear speck
GO:0031982	vesicle
GO:0032991	protein-containing complex
GO:0048471	perinuclear region of cytoplasm
GO:0070062	extracellular exosome
GO:0072562	blood microparticle
GO:1904813	ficolin-1-rich granule lumen
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7kw7, PDBe:7kw7, PDBj:7kw7
PDBsum	7kw7
PubMed	34937942
UniProt	P0DMV8\|HS71A_HUMAN Heat shock 70 kDa protein 1A (Gene Name=HSPA1A)

[Back to BioLiP]