Structure of PDB 7kra Chain D

Receptor sequence
>7kraD (length=68) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
EWAKHLLDTKYIEKYNIQMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDW
LPWERIAHYNNGLQWFSD
3D structure
PDB7kra Structural and mechanistic basis of the EMC-dependent biogenesis of distinct transmembrane clients.
ChainD
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D Q148 L159 Q26 L37
BS02 peptide D F147 L151 F25 L29
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0032977 membrane insertase activity
Biological Process
GO:0006644 phospholipid metabolic process
GO:0015914 phospholipid transport
GO:0034975 protein folding in endoplasmic reticulum
GO:0045050 protein insertion into ER membrane by stop-transfer membrane-anchor sequence
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0072546 EMC complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kra, PDBe:7kra, PDBj:7kra
PDBsum7kra
PubMed33236988
UniProtP53073|EMC4_YEAST ER membrane protein complex subunit 4 (Gene Name=EMC4)

[Back to BioLiP]