Structure of PDB 7koe Chain D

Receptor sequence
>7koeD (length=92) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence]
MRIEDKLYLNRYRTDEENPHLKIKDESICAEKCSDRPCVSCCPADVYEWT
ESGMEVKFEGCLECGTCRIVCPFGNIEWNYPRGNYGVLYKFG
3D structure
PDB7koe Cryoelectron microscopy structure and mechanism of the membrane-associated electron-bifurcating flavoprotein Fix/EtfABCX.
ChainD
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 FAD D Y450 E497 G498 Y12 E59 G60
BS02 SF4 D C480 P481 V484 C499 L500 E501 C502 G503 C505 W516 C42 P43 V46 C61 L62 E63 C64 G65 C67 W78
BS03 SF4 D C467 C471 R474 P475 C476 C509 N513 C29 C33 R36 P37 C38 C71 N75
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 30 05:44:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7koe', asym_id = 'D', title = 'Cryoelectron microscopy structure and mechanism ...ed electron-bifurcating flavoprotein Fix/EtfABCX.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7koe', asym_id='D', title='Cryoelectron microscopy structure and mechanism ...ed electron-bifurcating flavoprotein Fix/EtfABCX.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005506,0051536', uniprot = '', pdbid = '7koe', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005506,0051536', uniprot='', pdbid='7koe', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>